PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 408aa    MW: 46416.9 Da    PI: 7.9569
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026613genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.12.6e-191053245
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 + en+  rq t+ kR++gilKKA+ELS+LCd+ + +++fs+tgk
  Lus10026613 10 KLENTNGRQATYGKRKHGILKKANELSILCDIPIILLMFSPTGK 53
                 6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.142153IPR002100Transcription factor, MADS-box
CDDcd002662.63E-22281No hitNo description
SuperFamilySSF554559.03E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-15323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-161154IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YGKRKHGILK KANELSILCD IPIILLMFSP TGKPSLCKGK  60
RSIEEVVTKF AQLTPQERTK RKLESLEALK KTFKKLDHDV NISEFFGSSS QTIEDLTNQA  120
NLLENQISET RKRLSYWTNA DEIHSVDHLE QLENSVRESL SRIQAHKEYL GKQQIVSLDC  180
NSQPCLQFQN EMQMPFRMNP EQQQFPPLQQ WLPNCDNQHF MLPDDPNLLP QRDIECSASS  240
SYGSYSGYYP TGKASDLSNS RQESAVSGIL NELHGNTSLR MQLPGQQYPQ YMPYNLNLLN  300
EVKFQPAPEM SLQEIPADFH LNGSFEVPKP GYCTTPGSWA STSGPCSVTM FDDQLFSQVH  360
PPLPVTKPST FTCYMKPLLT FKAMNRYYDM LHSGIALFYY FSSTVLR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576858.10.0PREDICTED: agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-102AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A067KYG70.0A0A067KYG7_JATCU; Uncharacterized protein
STRINGPOPTR_0008s08780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-91AGAMOUS-like 30